CRYGC, Mouse, Clone: 7C4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CRYGC.

Manufacturer: Abnova Corporation H00001420M01C

Catalog No. 89-021-177

  Check Availability
Add to Cart

    Specifications

    Antigen CRYGC
    Applications Enzyme Linked Immunosorbent Assay,Sandwich ELISA,Western Blotting
    Clone 7C4
    Conjugate Unlabeled
    Cross Reactivity Human
    Description crystallin, gamma C
    Format Ascites
    Formulation In ascites fluid
    Gene CRYGC
    Gene Accession No. NM_020989
    Gene Alias CCL, CRYG3
    Gene Symbols CRYGC
    Host Species Mouse
    Immunogen CRYGC (NP_066269, 75 a.a. ∽175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1420

    Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq

    Sequence: SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit