crystallin, gamma C, Mouse, Clone: 7C4, Abnova™

Catalog No.	Quantity
89-000-591	100 μg

Catalog No. 89-000-591 Supplier Abnova Corporation Supplier No. H00001420M01J

Description

Mouse monoclonal antibody raised against a partial recombinant CRYGC.

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq

Sequence: SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY

Specifications

• Antigen: crystallin, gamma C
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 7C4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CRYGC.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CRYGC
• Gene Accession No.: NM_020989
• Gene Alias: CCL/CRYG3
• Gene Symbols: CRYGC
• Host Species: Mouse
• Immunogen: CRYGC (NP_066269, 75 a.a. ∼ 174 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1420
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ