CRYM, Mouse, Clone: 1C6, Abnova™

Catalog No.	Quantity
89-021-181	100 μg

Catalog No. 89-021-181 Supplier Abnova Corporation Supplier No. H00001428M09

Description

Mouse monoclonal antibody raised against a partial recombinant CRYM.

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK

Specifications

• Antigen: CRYM
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CRYM.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CRYM
• Gene Accession No.: NM_001888
• Gene Alias: DFNA40/THBP
• Gene Symbols: CRYM
• Host Species: Mouse
• Immunogen: CRYM (NP_001879, 215 a.a. ∼ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1428
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ