crystallin, zeta (quinone reductase), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-081	50 μL

Catalog No. 89-004-081 Supplier Abnova Corporation Supplier No. H00001429A01

Description

Mouse polyclonal antibody raised against a partial recombinant CRYZ.

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq

Sequence: ATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTIS

Specifications

• Antigen: crystallin, zeta (quinone reductase)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CRYZ.
• Formulation: 50% glycerol
• Gene: CRYZ
• Gene Accession No.: NM_001889
• Gene Alias: DKFZp779E0834/FLJ41475
• Gene Symbols: CRYZ
• Host Species: Mouse
• Immunogen: CRYZ (NP_001880, 2 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1429
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum