CSF1R, Mouse, Clone: 1G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CSF1R.

Supplier:  Abnova Corporation H00001436M01

Catalog No. 89-021-190

Description

The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. [provided by RefSeq

Sequence: PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED

Specifications

• Antigen: CSF1R
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC047521
• Gene Symbols: CSF1R
• Immunogen: CSF1R (AAH47521, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, In situ PLA, Western Blot
• Clone: 1G4
• Description: Mouse monoclonal antibody raised against a partial recombinant CSF1R.
• Gene: CSF1R
• Gene Alias: C-FMS/CD115/CSFR/FIM2/FMS
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1436
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid