CSNK2A1, Mouse, Clone: 3D9, Abnova™

Catalog No.	Quantity
89-021-196	100 μg

Catalog No. 89-021-196 Supplier Abnova Corporation Supplier No. H00001457M01

Description

Mouse monoclonal antibody raised against a partial recombinant CSNK2A1.

Casein kinase II is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. The kinase exists as a tetramer and is composed of an alpha, an alpha-prime, and two beta subunits. The alpha subunits contain the catalytic activity while the beta subunits undergo autophosphorylation. The protein encoded by this gene represents the alpha subunit. While this gene is found on chromosome 20, a related transcribed pseudogene is found on chromosome 11. Three transcript variants encoding two different proteins have been found for this gene. [provided by RefSeq

Sequence: MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI

Specifications

• Antigen: CSNK2A1
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 3D9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CSNK2A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CSNK2A1
• Gene Accession No.: BC011668
• Gene Alias: CK2A1/CKII
• Gene Symbols: CSNK2A1
• Host Species: Mouse
• Immunogen: CSNK2A1 (AAH11668, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1457
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ