CSTA, Mouse, Clone: 4D8, Abnova™

Catalog No.	Quantity
89-021-204	100 μg

Catalog No. 89-021-204 Supplier Abnova Corporation Supplier No. H00001475M14

Description

Mouse monoclonal antibody raised against a full-length recombinant CSTA.

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq

Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Specifications

• Antigen: CSTA
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4D8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant CSTA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CSTA
• Gene Accession No.: BC010379
• Gene Alias: STF1/STFA
• Gene Symbols: CSTA
• Host Species: Mouse
• Immunogen: CSTA (AAH10379, 1 a.a. ∼ 98 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1475
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ