cystatin B (stefin B), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CSTB protein.

Supplier:  Abnova Corporation H00001476D01P

Catalog No. 89-017-545

Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). [provided by RefSeq

Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Specifications

• Antigen: cystatin B (stefin B)
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CSTB protein.
• Gene: CSTB
• Gene Alias: CST6/EPM1/PME/STFB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1476
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000100.2
• Gene Symbols: CSTB
• Immunogen: CSTB (NP_000091.1, 1 a.a. ∼ 98 a.a) full-length human protein.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody