cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, Mouse, Clone: 1D4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CSTF3.

Supplier:  Abnova Corporation H00001479M01

Catalog No. 89-014-084

Description

The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN

Specifications

• Antigen: cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC009792
• Gene Symbols: CSTF3
• Immunogen: CSTF3 (AAH09792, 1 a.a. ∼ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Clone: 1D4
• Description: Mouse monoclonal antibody raised against a full length recombinant CSTF3.
• Gene: CSTF3
• Gene Alias: CSTF-77/MGC117398/MGC43001/MGC75122
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1479
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ