cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa, Mouse, Clone: 1D4, Abnova™

Catalog No.	Quantity
89-014-084	100 μg

Catalog No. 89-014-084 Supplier Abnova Corporation Supplier No. H00001479M01

Description

Mouse monoclonal antibody raised against a full-length recombinant CSTF3.

The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN

Specifications

• Antigen: cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1D4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant CSTF3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CSTF3
• Gene Accession No.: BC009792
• Gene Alias: CSTF-77/MGC117398/MGC43001/MGC75122
• Gene Symbols: CSTF3
• Host Species: Mouse
• Immunogen: CSTF3 (AAH09792, 1 a.a. ∼ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1479
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ