CTLA4 (M08A), Mouse anti-Human, Clone: 1F4, Abnova™

Catalog No.	Quantity
89-021-221	200 μL

Catalog No. 89-021-221 Supplier Abnova Corporation Supplier No. H00001493M08A

Description

Mouse monoclonal antibody raised against a partial recombinant CTLA4.

This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq

Sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY

Specifications

• Antigen: CTLA4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CTLA4.
• Formulation: ascites with no preservative
• Gene: CTLA4
• Gene Accession No.: NM_005214
• Gene Alias: CD152/CELIAC3/CTLA-4/GSE/IDDM12
• Gene Symbols: CTLA4
• Host Species: Mouse
• Immunogen: CTLA4 (NP_005205, 36 a.a. ∼ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1493
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ