catenin (cadherin-associated protein), beta 1, 88kDa, Mouse, Clone: 1C9, Abnova™

Catalog No.	Quantity
89-000-600	100 μg

Catalog No. 89-000-600 Supplier Abnova Corporation Supplier No. H00001499M02

Description

Mouse monoclonal antibody raised against a partial recombinant CTNNB1.

Beta-catenin is an adherens junction protein. Adherens junctions (AJs; also called the zonula adherens) are critical for the establishment and maintenance of epithelial layers, such as those lining organ surfaces. AJs mediate adhesion between cells, communicate a signal that neighboring cells are present, and anchor the actin cytoskeleton. In serving these roles, AJs regulate normal cell growth and behavior. At several stages of embryogenesis, wound healing, and tumor cell metastasis, cells form and leave epithelia. This process, which involves the disruption and reestablishment of epithelial cell-cell contacts, may be regulated by the disassembly and assembly of AJs. AJs may also function in the transmission of the 'contact inhibition' signal, which instructs cells to stop dividing once an epithelial sheet is complete.[supplied by OMIM

Sequence: LFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Specifications

• Antigen: catenin (cadherin-associated protein), beta 1, 88kDa
• Applications: ELISA, Immunofluorescence, In situ PLA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 1C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CTNNB1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CTNNB1
• Gene Accession No.: NM_001904
• Gene Alias: CTNNB/DKFZp686D02253/FLJ25606/FLJ37923
• Gene Symbols: CTNNB1
• Host Species: Mouse
• Immunogen: CTNNB1 (AAH58926, 682 a.a. ∼ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1499
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ