Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CTNND2.

Manufacturer:  Abnova Corporation H00001501A01

Catalog No. 89-004-087


Add to cart

Description

Description

Sequence: ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Specifications

Specifications

catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
Unconjugated
50% glycerol
NM_001332
GT24|NPRAP
Mouse
50 uL
Cell Adhesion
Y
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CTNND2.
CTNND2
Serum
CTNND2
CTNND2 (NP_001323, 1081 a.a. ~ 1190 a.a) partial recombinant protein with GST tag.
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1501
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit