Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CTNS, Mouse, Clone: 5G6, Abnova™

Catalog No. 89021222 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-222 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-222 Supplier Abnova Corporation Supplier No. H00001497M09
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CTNS.

This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY

Specifications

Antigen CTNS
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5G6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CTNS.
Formulation PBS with no preservative; pH 7.4
Gene CTNS
Gene Accession No. NM_004937
Gene Alias CTNS-LSB/PQLC4
Gene Symbols CTNS
Host Species Mouse
Immunogen CTNS (NP_004928, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1497
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.