CTSK, Mouse, Clone: 1B11, Abnova™

Catalog No.	Quantity
89-021-232	100 μg

Catalog No. 89-021-232 Supplier Abnova Corporation Supplier No. H00001513M03

Description

Mouse monoclonal antibody raised against a partial recombinant CTSK.

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. [provided by RefSeq

Sequence: KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Specifications

• Antigen: CTSK
• Applications: ELISA
• Classification: Monoclonal
• Clone: 1B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CTSK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CTSK
• Gene Accession No.: BC016058
• Gene Alias: CTS02/CTSO/CTSO1/CTSO2/MGC23107/PKND/PYCD
• Gene Symbols: CTSK
• Host Species: Mouse
• Immunogen: CTSK (AAH16058, 220 a.a. ∼ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1513
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ