Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cut-like homeobox 1, Mouse, Clone: 2D10, Abnova™

Catalog No. 89000601 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-601 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-601 Supplier Abnova Corporation Supplier No. H00001523M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CUTL1.

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI

Specifications

Antigen cut-like homeobox 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CUTL1.
Formulation PBS with no preservative; pH 7.4
Gene CUX1
Gene Accession No. NM_001913
Gene Alias CASP/CDP/CDP/Cut/CDP1/COY1/CUTL1/CUX/Clox/Cux/CDP/GOLIM6/Nbla10317/p100/p110/p200/p75
Gene Symbols CUX1
Host Species Mouse
Immunogen CUTL1 (NP_001904.2, 521 a.a. ∼ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 1523
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.