cut-like homeobox 1, Mouse, Clone: 2D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CUTL1.

Supplier:  Abnova Corporation H00001523M02

Catalog No. 89-000-601

Description

The protein encoded by this gene is a member of the homeodomain family of DNA binding proteins. It may regulate gene expression, morphogenesis, and differentiation and it may also play a role in the cell cycle progession. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq

Sequence: AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPGRGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLSPWDKATLSMGRLVLSNKMARTI

Specifications

• Antigen: cut-like homeobox 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001913
• Gene Symbols: CUX1
• Immunogen: CUTL1 (NP_001904.2, 521 a.a. ∼ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2D10
• Description: Mouse monoclonal antibody raised against a partial recombinant CUTL1.
• Gene: CUX1
• Gene Alias: CASP/CDP/CDP/Cut/CDP1/COY1/CUTL1/CUX/Clox/Cux/CDP/GOLIM6/Nbla10317/p100/p110/p200/p75
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 1523
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ