chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-696	100 μg

Catalog No. 89-017-696 Supplier Abnova Corporation Supplier No. H00002919D01P

Description

Rabbit polyclonal antibody raised against a full-length human CXCL1 protein.

Chemokines are a group of small (approximately 8 to 14kDa), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif. ELR types are chemotactic for neutrophils, while non-ELR types are chemotactic for lymphocytes.[supplied by OMIM

Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Specifications

• Antigen: chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CXCL1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CXCL1
• Gene Accession No.: NM_001511
• Gene Alias: FSP/GRO1/GROa/MGSA/MGSA-a/NAP-3/SCYB1
• Gene Symbols: CXCL1
• Host Species: Rabbit
• Immunogen: CXCL1 (NP_001502.1, 1 a.a. ∼ 107 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 2919
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG