chemokine (C-X-C motif) ligand 10, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CXCL10 protein.

Supplier:  Abnova Corporation H00003627D01P

Catalog No. 89-017-783

Description

This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq

Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP

Specifications

• Antigen: chemokine (C-X-C motif) ligand 10
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CXCL10 protein.
• Gene: CXCL10
• Gene Alias: C7/IFI10/INP10/IP-10/SCYB10/crg-2/gIP-10/mob-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001565
• Gene Symbols: CXCL10
• Immunogen: CXCL10 (NP_001556.1, 1 a.a. ∼ 98 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 3627
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG