chemokine (C-X-C motif) ligand 11, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-260	100 μg

Catalog No. 89-018-260 Supplier Abnova Corporation Supplier No. H00006373D01P

Description

Rabbit polyclonal antibody raised against a full-length human CXCL11 protein.

Chemokines are a group of small (approximately 8 to 14kDa), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq

Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Specifications

• Antigen: chemokine (C-X-C motif) ligand 11
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CXCL11 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CXCL11
• Gene Accession No.: NM_005409
• Gene Alias: H174/I-TAC/IP-9/IP9/MGC102770/SCYB11/SCYB9B/b-R1
• Gene Symbols: CXCL11
• Host Species: Rabbit
• Immunogen: CXCL11 (NP_005400.1, 1 a.a. ∼ 94 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cytokines
• Primary or Secondary: Primary
• Gene ID (Entrez): 6373
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG