CXCL12, Mouse, Clone: 2E2, Abnova™

Catalog No.	Quantity
89-123-286	100 μg

Catalog No. 89-123-286 Supplier Abnova Corporation Supplier No. H00006387M05

Description

Mouse monoclonal antibody raised against a full-length recombinant CXCL12.

For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM

Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Specifications

• Antigen: CXCL12
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant CXCL12.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CXCL12
• Gene Accession No.: BC039893
• Gene Alias: PBSF/SCYB12/SDF-1a/SDF-1b/SDF1/SDF1A/SDF1B/TLSF-a/TLSF-b/TPAR1
• Gene Symbols: CXCL12
• Host Species: Mouse
• Immunogen: CXCL12 (AAH39893.1, 1 a.a. ∼ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6387
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ