CXCL5 (M05), Mouse anti-Human, Clone: 2A9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CXCL5.

Supplier:  Abnova Corporation H00006374M05

Catalog No. 89-000-957

Description

The protein encoded by this gene is an inflammatory chemokine that belongs to the CXC chemokine family. This chemokine is produced concomitantly with interleukin-8 (IL8) in response to stimulation with either interleukin-1 (IL1) or tumor necrosis factor-alpha (TNFA). This chemokine is a potent chemotaxin involved in neutrophil activation. [provided by RefSeq

Sequence: MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN

Specifications

• Antigen: CXCL5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC008376
• Gene Symbols: CXCL5
• Immunogen: CXCL5 (AAH08376, 1 a.a. ∼ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 2A9
• Description: Mouse monoclonal antibody raised against a full length recombinant CXCL5.
• Gene: CXCL5
• Gene Alias: ENA-78/SCYB5
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 6374
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid