Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89002726

CXCR4, Mouse, Clone: 2A9, Abnova™

Catalog No. 89002726 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-726 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-726 Supplier Abnova Corporation Supplier No. H00007852M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CXCR4.

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Specifications

Antigen CXCR4,
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2A9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CXCR4.
Formulation PBS with no preservative; pH 7.4
Gene CXCR4
Gene Accession No. BC020968
Gene Alias CD184/D2S201E/FB22/HM89/HSY3RR/LAP3/LCR1/LESTR/NPY3R/NPYR/NPYRL/NPYY3R/WHIM
Gene Symbols CXCR4
Host Species Mouse
Immunogen CXCR4 (AAH20968, 1 a.a. ∼ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7852
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.