CYB5R3, Mouse, Clone: 2A9, Abnova™

Catalog No.	Quantity
89-021-298	100 μg

Catalog No. 89-021-298 Supplier Abnova Corporation Supplier No. H00001727M01

Description

Mouse monoclonal antibody raised against a partial recombinant CYB5R3.

This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. These two forms are resulted from alternative splicing of the gene. Mutations in this gene cause methemoglobinemias. [provided by RefSeq

Sequence: FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF

Specifications

• Antigen: CYB5R3
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYB5R3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYB5R3
• Gene Accession No.: BC004821
• Gene Alias: B5R/DIA1
• Gene Symbols: CYB5R3
• Host Species: Mouse
• Immunogen: CYB5R3 (AAH04821.1, 157 a.a. ∼ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1727
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ