Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021243

CYLD, Mouse, Clone: 2F9, Abnova™

Catalog No. 89021243 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-243 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-243 Supplier Abnova Corporation Supplier No. H00001540M08
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CYLD.

This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Specifications

Antigen CYLD
Applications ELISA
Classification Monoclonal
Clone 2F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CYLD.
Formulation PBS with no preservative; pH 7.4
Gene CYLD
Gene Accession No. BC012342
Gene Alias CDMT/CYLD1/CYLDI/EAC/FLJ20180/FLJ31664/FLJ78684/HSPC057/KIAA0849/MFT/MFT1/SBS/TEM/USPL2
Gene Symbols CYLD
Host Species Mouse
Immunogen CYLD (AAH12342, 854 a.a. ∼ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1540
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.