cylindromatosis (turban tumor syndrome), Mouse, Clone: 3A9, Abnova™

Catalog No.	Quantity
89-000-602	100 μg

Catalog No. 89-000-602 Supplier Abnova Corporation Supplier No. H00001540M02

Description

Mouse monoclonal antibody raised against a partial recombinant CYLD.

This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Specifications

• Antigen: cylindromatosis (turban tumor syndrome)
• Applications: ELISA, Immunofluorescence
• Classification: Monoclonal
• Clone: 3A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYLD.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYLD
• Gene Accession No.: BC012342
• Gene Alias: CDMT/CYLD1/CYLDI/EAC/FLJ20180/FLJ31664/FLJ78684/HSPC057/KIAA0849/MFT/MFT1/SBS/TEM/USPL2
• Gene Symbols: CYLD
• Host Species: Mouse
• Immunogen: CYLD (AAH12342, 854 a.a. ∼ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1540
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ