cytochrome P450, family 1, subfamily A, polypeptide 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-088	50 μL

Catalog No. 89-004-088 Supplier Abnova Corporation Supplier No. H00001544A01

Description

Mouse polyclonal antibody raised against a partial recombinant CYP1A2.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. Other xenobiotic substrates for this enzyme include caffeine, aflatoxin B1, and acetaminophen. The transcript from this gene contains four Alu sequences flanked by direct repeats in the 3' untranslated region. [provided by RefSeq]

Sequence: ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL

Specifications

• Antigen: cytochrome P450, family 1, subfamily A, polypeptide 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CYP1A2.
• Formulation: 50% glycerol
• Gene: CYP1A2
• Gene Accession No.: NM_000761
• Gene Alias: CP12/P3-450/P450(PA)
• Gene Symbols: CYP1A2
• Host Species: Mouse
• Immunogen: CYP1A2 (NP_000752, 211 a.a. ∼ 310 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1544
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum