CYP1B1, Mouse, Clone: 2F8, Abnova™

Catalog No.	Quantity
89-021-245	100 μg

Catalog No. 89-021-245 Supplier Abnova Corporation Supplier No. H00001545M03

Description

Mouse monoclonal antibody raised against a partial recombinant CYP1B1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. [provided by RefSeq

Sequence: NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC

Specifications

• Antigen: CYP1B1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP1B1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYP1B1
• Gene Accession No.: NM_000104
• Gene Alias: CP1B/GLC3A/P4501B1
• Gene Symbols: CYP1B1
• Host Species: Mouse
• Immunogen: CYP1B1 (NP_000095, 453 a.a. ∼ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1545
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ