cytochrome P450, family 24, subfamily A, polypeptide 1, Mouse, Clone: 1F8, Abnova™

Catalog No.	Quantity
89-014-087	100 μg

Catalog No. 89-014-087 Supplier Abnova Corporation Supplier No. H00001591M07

Description

Mouse monoclonal antibody raised against a partial recombinant CYP24A1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

Specifications

• Antigen: cytochrome P450, family 24, subfamily A, polypeptide 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP24A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYP24A1
• Gene Accession No.: NM_000782
• Gene Alias: CP24/CYP24/MGC126273/MGC126274/P450-CC24
• Gene Symbols: CYP24A1
• Host Species: Mouse
• Immunogen: CYP24A1 (NP_000773, 415 a.a. ∼ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1591
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ