CYP2D6, Mouse, Clone: 2C5, Abnova™

Catalog No.	Quantity
89-123-147	100 μg

Catalog No. 89-123-147 Supplier Abnova Corporation Supplier No. H00001565M07

Description

Mouse monoclonal antibody raised against a partial recombinant CYP2D6.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: LVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLT

Specifications

• Antigen: CYP2D6
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP2D6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYP2D6
• Gene Accession No.: NG_003180
• Gene Alias: CPD6/CYP2D/CYP2D@/CYP2DL1/MGC120389/MGC120390/P450-DB1/P450C2D/P450DB1
• Gene Symbols: CYP2D6
• Host Species: Mouse
• Immunogen: CYP2D6 (NP_000097, 91 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1565
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ