CYP46A1, Mouse, Clone: 2B5, Abnova™

Catalog No.	Quantity
89-002-777	100 μg

Catalog No. 89-002-777 Supplier Abnova Corporation Supplier No. H00010858M02

Description

Mouse monoclonal antibody raised against a partial recombinant CYP46A1.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. [provided by RefSeq

Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF

Specifications

• Antigen: CYP46A1
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 2B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP46A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CYP46A1
• Gene Accession No.: NM_006668
• Gene Alias: CP46/CYP46
• Gene Symbols: CYP46A1
• Host Species: Mouse
• Immunogen: CYP46A1 (NP_006659, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10858
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ