CYP46A1, Mouse, Clone: 2B5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CYP46A1.

Supplier:  Abnova Corporation H00010858M02

Catalog No. 89-002-777

Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. [provided by RefSeq

Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF

Specifications

• Antigen: CYP46A1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006668
• Gene Symbols: CYP46A1
• Immunogen: CYP46A1 (NP_006659, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 2B5
• Description: Mouse monoclonal antibody raised against a partial recombinant CYP46A1.
• Gene: CYP46A1
• Gene Alias: CP46/CYP46
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 10858
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid