dishevelled associated activator of morphogenesis 1, Mouse, Clone: 4H3, Abnova™

Catalog No.	Quantity
89-001-220	100 μg

Catalog No. 89-001-220 Supplier Abnova Corporation Supplier No. H00023002M03

Description

Mouse monoclonal antibody raised against a partial recombinant DAAM1.

Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq

Sequence: MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL

Specifications

• Antigen: dishevelled associated activator of morphogenesis 1
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 4H3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DAAM1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DAAM1
• Gene Accession No.: NM_014992
• Gene Alias: FLJ41657/KIAA0666
• Gene Symbols: DAAM1
• Host Species: Mouse
• Immunogen: DAAM1 (NP_055807, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23002
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ