DAG1, Mouse, Clone: 2A3, Abnova™

Catalog No.	Quantity
89-021-255	100 μg

Catalog No. 89-021-255 Supplier Abnova Corporation Supplier No. H00001605M01

Description

Mouse monoclonal antibody raised against a partial recombinant DAG1.

Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix. Dystroglycan 1 is a candidate gene for the site of the mutation in autosomal recessive muscular dystrophies. The dramatic reduction of dystroglycan 1 in Duchenne muscular dystrophy leads to a loss of linkage between the sarcolemma and extracellular matrix, rendering muscle fibers more susceptible to necrosis. Dystroglycan also functions as dual receptor for agrin and laminin-2 in the Schwann cell membrane. The muscle and nonmuscle isoforms of dystroglycan differ by carbohydrate moieties but not protein sequence. Alternative splicing results in multiple transcript variants

Sequence: WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA

Specifications

• Antigen: DAG1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DAG1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DAG1
• Gene Accession No.: BC012740
• Gene Alias: 156DAG/A3a/AGRNR/DAG
• Gene Symbols: DAG1
• Host Species: Mouse
• Immunogen: DAG1 (AAH12740, 31 a.a. ∼ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1605
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ