DAP, Mouse, Clone: 3C5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant DAP.

Supplier:  Abnova Corporation H00001611M01

Catalog No. 89-021-258

Description

This gene encodes a basic, proline-rich, 15kDa protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. [provided by RefSeq

Sequence: MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

Specifications

• Antigen: DAP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC002726
• Gene Symbols: DAP
• Immunogen: DAP (AAH02726, 1 a.a. ∼ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3C5
• Description: Mouse monoclonal antibody raised against a full-length recombinant DAP.
• Gene: DAP
• Gene Alias: MGC99796
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1611
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid