DAXX, Mouse, Clone: 4C2, Abnova™

Catalog No.	Quantity
89-021-260	100 μg

Catalog No. 89-021-260 Supplier Abnova Corporation Supplier No. H00001616M03

Description

Mouse monoclonal antibody raised against a partial recombinant DAXX.

This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNG

Specifications

• Antigen: DAXX
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 4C2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DAXX.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DAXX
• Gene Accession No.: NM_001350
• Gene Alias: BING2/DAP6/EAP1/MGC126245/MGC126246
• Gene Symbols: DAXX
• Host Species: Mouse
• Immunogen: DAXX (NP_001341, 561 a.a. ∼ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1616
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ