deleted in azoospermia 1, Mouse, Clone: 3E3, Abnova™

Catalog No.	Quantity
89-000-604	100 μg

Catalog No. 89-000-604 Supplier Abnova Corporation Supplier No. H00001617M06

Description

Mouse monoclonal antibody raised against a partial recombinant DAZ1.

This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4kb repeat including a 72bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains. [provided by RefSeq

Sequence: SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC

Specifications

• Antigen: deleted in azoospermia 1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DAZ1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DAZ1
• Gene Accession No.: NG_004755
• Gene Alias: DAZ/SPGY
• Gene Symbols: DAZ1
• Host Species: Mouse
• Immunogen: DAZ1 (AAH18119, 21 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1617
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ