diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-090	50 μL

Catalog No. 89-004-090 Supplier Abnova Corporation Supplier No. H00001622A01

Description

Mouse polyclonal antibody raised against a partial recombinant DBI.

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Specifications

• Antigen: diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DBI.
• Formulation: 50% glycerol
• Gene: DBI
• Gene Accession No.: NM_020548
• Gene Alias: ACBD1/ACBP/CCK-RP/EP/MGC70414
• Gene Symbols: DBI
• Host Species: Mouse
• Immunogen: DBI (NP_065438, 1 a.a. ∼ 104 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1622
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum