Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021262

DBP, Mouse, Clone: 3A6, Abnova™

Catalog No. 89021262 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-262 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-262 Supplier Abnova Corporation Supplier No. H00001628M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DBP.

DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family (Khatib et al., 1994 [PubMed 7835883]).[supplied by OMIM

Sequence: RRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL

Specifications

Antigen DBP
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3A6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DBP.
Formulation PBS with no preservative; pH 7.4
Gene DBP
Gene Accession No. NM_001352
Gene Alias DABP
Gene Symbols DBP
Host Species Mouse
Immunogen DBP (NP_001343, 226 a.a. ∼ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1628
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.