Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DCP1 decapping enzyme homolog A (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DCP1A.

Manufacturer:  Abnova Corporation H00055802A01

Catalog No. 89-004-675


Add to cart

Description

Description

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq

Sequence: STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Specifications

Specifications

DCP1 decapping enzyme homolog A (S. cerevisiae)
Unconjugated
50% glycerol
NM_018403
FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
55802
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant DCP1A.
DCP1A
Serum
DCP1A
DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit