DCP1 decapping enzyme homolog A (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DCP1A.

Manufacturer:  Abnova Corporation H00055802A01

Catalog No. 89-004-675

Description

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. [provided by RefSeq

Sequence: STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ

Specifications

• Antigen: DCP1 decapping enzyme homolog A (S. cerevisiae)
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_018403
• Gene Alias: FLJ21691|HSA275986|Nbla00360|SMAD4IP1|SMIF
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 55802

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant DCP1A.
• Gene: DCP1A
• Format: Serum
• Gene Symbols: DCP1A
• Immunogen: DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human, Murine