Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DCUN1D1.

Manufacturer:  Abnova Corporation H00054165A01

Catalog No. 89-004-644


Add to cart

Description

Description

Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Specifications

Specifications

DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
Unconjugated
50% glycerol
NM_020640
DCUN1L1|RP42|SCCRO|SCRO|Tes3
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
54165
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant DCUN1D1.
DCUN1D1
Serum
DCUN1D1
DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit