DDB1, Mouse, Clone: 4C5, Abnova™

Catalog No.	Quantity
89-021-276	100 μg

Catalog No. 89-021-276 Supplier Abnova Corporation Supplier No. H00001642M01

Description

Mouse monoclonal antibody raised against a partial recombinant DDB1.

This gene encodes the large subunit of DNA damage-binding protein which is a heterodimer composed of a large and a small subunit. This protein functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. [provided by RefSeq

Sequence: SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Specifications

• Antigen: DDB1
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DDB1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DDB1
• Gene Accession No.: NM_001923
• Gene Alias: DDBA/UV-DDB1/XAP1/XPCE/XPE/XPE-BF
• Gene Symbols: DDB1
• Host Species: Mouse
• Immunogen: DDB1 (NP_001914, 1044 a.a. ∼ 1140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1642
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ