damage-specific DNA binding protein 1, 127kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-092	50 μL

Catalog No. 89-004-092 Supplier Abnova Corporation Supplier No. H00001642A01

Description

Mouse polyclonal antibody raised against a partial recombinant DDB1.

This gene encodes the large subunit of DNA damage-binding protein which is a heterodimer composed of a large and a small subunit. This protein functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. [provided by RefSeq

Sequence: SESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH

Specifications

• Antigen: damage-specific DNA binding protein 1, 127kDa
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DDB1.
• Formulation: 50% glycerol
• Gene: DDB1
• Gene Accession No.: NM_001923
• Gene Alias: DDBA/UV-DDB1/XAP1/XPCE/XPE/XPE-BF
• Gene Symbols: DDB1
• Host Species: Mouse
• Immunogen: DDB1 (NP_001914, 1044 a.a. ∼ 1140 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1642
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum