DDX1, Mouse, Clone: 4F6, Abnova™

Catalog No.	Quantity
89-021-285	100 μg

Catalog No. 89-021-285 Supplier Abnova Corporation Supplier No. H00001653M02

Description

Mouse monoclonal antibody raised against a partial recombinant DDX1.

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. [provided by RefSeq

Sequence: RLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

Specifications

• Antigen: DDX1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DDX1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DDX1
• Gene Accession No.: NM_004939
• Gene Alias: DBP-RB/UKVH5d
• Gene Symbols: DDX1
• Host Species: Mouse
• Immunogen: DDX1 (NP_004930, 642 a.a. ∼ 740 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1653
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ