Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001347

DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, Mouse, Clone: 2E4, Abnova™

Catalog No. 89001347 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-347 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-347 Supplier Abnova Corporation Supplier No. H00079039M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DDX54.

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The nucleolar protein encoded by this gene interacts in a hormone-dependent manner with nuclear receptors, and represses their transcriptional activity. Alternative splice variants that encode different isoforms have been found for this gene. [provided by RefSeq

Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM

Specifications

Antigen DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 2E4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DDX54.
Formulation PBS with no preservative; pH 7.4
Gene DDX54
Gene Accession No. NM_024072
Gene Alias DP97/MGC2835
Gene Symbols DDX54
Host Species Mouse
Immunogen DDX54 (NP_076977, 778 a.a. ∼ 881 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 79039
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.