Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

2,4-dienoyl CoA reductase 2, peroxisomal, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human DECR2 protein.

Manufacturer:  Abnova Corporation H00026063B01P

Catalog No. 89-017-046


  Check Availability
Add to cart

Specifications

Description

Sequence: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL
Description & Specifications

Specifications

2,4-dienoyl CoA reductase 2, peroxisomal
Unlabeled
2,4-dienoyl CoA reductase 2, peroxisomal
In 1X PBS, pH 7.4
NM_020664
DECR2
DECR2 (NP_065715, 1 a.a. ∽292 a.a) full-length human protein.
50μg
Endocrine/Metabolism
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human,Rat
Western Blot
Human,Rat
Affinity Purified
DECR2
PDCR, SDR17C1
Murine
Protein A column
RUO
Human, Rat
Primary
26063
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit