death effector domain containing, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-427	50 μL

Catalog No. 89-004-427 Supplier Abnova Corporation Supplier No. H00009191A01

Description

Mouse polyclonal antibody raised against a partial recombinant DEDD.

This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak apoptosis. Upon stimulation, this protein was found to translocate from cytoplasm to nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: IITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEK

Specifications

• Antigen: death effector domain containing
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DEDD.
• Formulation: 50% glycerol
• Gene: DEDD
• Gene Accession No.: NM_032998
• Gene Alias: CASP8IP1/DEDD1/DEFT/FLDED1/KE05
• Gene Symbols: DEDD
• Host Species: Mouse
• Immunogen: DEDD (NP_127491, 91 a.a. ∼ 190 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9191
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum