Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021292

DEFB4, Mouse, Clone: 4C4, Abnova™

Catalog No. 89021292 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-292 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-292 Supplier Abnova Corporation Supplier No. H00001673M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DEFB4.

Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq

Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Specifications

Antigen DEFB4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4C4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DEFB4.
Formulation PBS with no preservative; pH 7.4
Gene DEFB4
Gene Accession No. NM_004942
Gene Alias DEFB-2/DEFB102/DEFB2/HBD-2/SAP1
Gene Symbols DEFB4
Host Species Mouse
Immunogen DEFB4 (NP_004933, 24 a.a. ∼ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1673
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.