Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021293

DES, Mouse, Clone: 1D12, Abnova™

Catalog No. 89021293 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-293 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-293 Supplier Abnova Corporation Supplier No. H00001674M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DES.

This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. [provided by RefSeq

Sequence: SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Specifications

Antigen DES
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DES.
Formulation PBS with no preservative; pH 7.4
Gene DES
Gene Accession No. NM_001927
Gene Alias CMD1I/CSM1/CSM2/FLJ12025/FLJ39719/FLJ41013/FLJ41793
Gene Symbols DES
Host Species Mouse
Immunogen DES (NP_001918.3, 361 a.a. ∼ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1674
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.