DiGeorge syndrome critical region gene 14, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-385	50 μL

Catalog No. 89-004-385 Supplier Abnova Corporation Supplier No. H00008220A01

Description

Mouse polyclonal antibody raised against a partial recombinant DGCR14.

This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq

Sequence: RVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF

Specifications

• Antigen: DiGeorge syndrome critical region gene 14
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant DGCR14.
• Formulation: 50% glycerol
• Gene: DGCR14
• Gene Accession No.: NM_022719
• Gene Alias: DGCR13/DGS-H/DGS-I/DGSH/DGSI/ES2/Es2el
• Gene Symbols: DGCR14
• Host Species: Mouse
• Immunogen: DGCR14 (NP_073210, 377 a.a. ∼ 476 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Neurobiology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8220
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum