DiGeorge syndrome critical region gene 14, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DGCR14.

Manufacturer:  Abnova Corporation H00008220A01

Catalog No. 89-004-385

Description

This gene is located within the minimal DGS critical region (MDGCR) thought to contain the gene(s) responsible for a group of developmental disorders. These disorders include DiGeorge syndrome, velocardiofacial syndrome, conotruncal anomaly face syndrome, and some familial or sporadic conotruncal cardiac defects which have been associated with microdeletion of 22q11.2. The encoded protein may be a component of C complex spliceosomes, and the orthologous protein in the mouse localizes to the nucleus. [provided by RefSeq

Sequence: RVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARSTHLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF

Specifications

• Antigen: DiGeorge syndrome critical region gene 14
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_022719
• Gene Alias: DGCR13|DGS-H|DGS-I|DGSH|DGSI|ES2|Es2el
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Neurobiology
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant DGCR14.
• Gene: DGCR14
• Format: Serum
• Gene Symbols: DGCR14
• Immunogen: DGCR14 (NP_073210, 377 a.a. ~ 476 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 8220