dihydrofolate reductase, Mouse, Clone: 2B10, Abnova™

Catalog No.	Quantity
89-014-092	100 μg

Catalog No. 89-014-092 Supplier Abnova Corporation Supplier No. H00001719M01

Description

Mouse monoclonal antibody raised against a partial recombinant DHFR.

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. [provided by RefSeq

Sequence: HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND

Specifications

• Antigen: dihydrofolate reductase
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DHFR.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DHFR
• Gene Accession No.: BC003584
• Gene Symbols: DHFR
• Host Species: Mouse
• Immunogen: DHFR (AAH03584, 88 a.a. ∼ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1719
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ