Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DLG1 (M01), Mouse anti-Human, Clone: 1D8, Abnova™

Catalog No. 89021305 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-305 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-305 Supplier Abnova Corporation Supplier No. H00001739M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant DLG1.

Sequence: MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS

Specifications

Antigen DLG1
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 1D8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DLG1.
Formulation PBS with no preservative; pH 7.4
Gene DLG1
Gene Accession No. NM_004087
Gene Alias DKFZp761P0818/DKFZp781B0426/DLGH1/SAP-97/SAP97/dJ1061C18.1.1/hdlg
Gene Symbols DLG1
Host Species Mouse
Immunogen DLG1 (NP_004078, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1739
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.