Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DLG1, Mouse, Clone: 1D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DLG1.

Manufacturer:  Abnova Corporation H00001739M01

Catalog No. 89-021-305


  Check Availability
Add to cart

Specifications

Description

Sequence: MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
Description & Specifications

Specifications

DLG1
1D8
discs, large homolog 1 (Drosophila)
DLG1
Liquid
DLG1
DLG1 (NP_004078, 1 a.a. ∽91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
50μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
NM_004087
DKFZp761P0818, DKFZp781B0426, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg
Murine
IgG2a, κ
RUO
Primary
1739
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit