DLG1, Mouse, Clone: 1D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DLG1.

Manufacturer: Abnova Corporation H00001739M01A

Catalog No. 89-021-306

  Check Availability
Add to Cart

    Specifications

    Antigen DLG1
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 1D8
    Conjugate Unlabeled
    Cross Reactivity Human
    Description discs, large homolog 1 (Drosophila)
    Format Ascites
    Formulation In ascites fluid
    Gene DLG1
    Gene Accession No. NM_004087
    Gene Alias DKFZp761P0818, DKFZp781B0426, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg
    Gene Symbols DLG1
    Host Species Mouse
    Immunogen DLG1 (NP_004078, 1 a.a. ∽91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1739

    Sequence: MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit